PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.L00665.1.p
Common NameLOC105965650, MIMGU_mgv1a012502mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family NF-YB
Protein Properties Length: 249aa    MW: 28277.8 Da    PI: 4.8607
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.L00665.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB177.71.1e-5590185297
             NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 
                       +eqdrflPianv+rimkkv+P+n+kiskdaketvqecvsefisfvt+eas+kcqrekrktingdd+lwa+ tlGfedyv+plk+yl+kyre+e
  Migut.L00665.1.p  90 KEQDRFLPIANVGRIMKKVIPGNGKISKDAKETVQECVSEFISFVTGEASEKCQREKRKTINGDDVLWAIMTLGFEDYVNPLKLYLAKYREIE 182
                       89******************************************************************************************* PP

             NF-YB  95 gek 97 
                       gek
  Migut.L00665.1.p 183 GEK 185
                       996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.9E-5384210IPR009072Histone-fold
SuperFamilySSF471134.66E-4092197IPR009072Histone-fold
PfamPF008085.1E-2895159IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.7E-19123141No hitNo description
PROSITE patternPS006850126142IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006153.7E-19142160No hitNo description
PRINTSPR006153.7E-19161179No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MKRERDFEDE SSQFDPNTTF GTRSKNSFST TINNNNNNNN NNNNNNNNNN NDDSNIIPIP  60
NNPTKSTTII EDDENNNSNN SNSNNNNNNK EQDRFLPIAN VGRIMKKVIP GNGKISKDAK  120
ETVQECVSEF ISFVTGEASE KCQREKRKTI NGDDVLWAIM TLGFEDYVNP LKLYLAKYRE  180
IEGEKLNVPK QQRMEQQQQQ QPMQHDPQKT YSSTNMMSQQ SFSSGGDPSF PLPFSQNSLP  240
PHAFDPNW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A4e-4590180393NF-YB
4awl_B3e-4590180494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A3e-4590180494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012845670.10.0PREDICTED: nuclear transcription factor Y subunit B-7 isoform X1
SwissprotQ9SIT92e-64NFYB7_ARATH; Nuclear transcription factor Y subunit B-7
TrEMBLA0A022QVH50.0A0A022QVH5_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000431765e-72(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G13570.11e-64nuclear factor Y, subunit B7